Protein Info for AMB_RS07265 in Magnetospirillum magneticum AMB-1

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1439)

Predicted SEED Role

"N-acetylmannosaminyltransferase (EC 2.4.1.187)" in subsystem Teichoic and lipoteichoic acids biosynthesis (EC 2.4.1.187)

MetaCyc Pathways

Salmonella enterica serotype O:54 O antigen biosynthesis (2/5 steps found)
poly(3-O-β-D-glucopyranosyl-N-acetylgalactosamine 1-phosphate) wall teichoic acid biosynthesis (3/10 steps found)
poly(glycerol phosphate) wall teichoic acid biosynthesis (3/11 steps found)
poly(ribitol phosphate) wall teichoic acid biosynthesis I (B. subtilis) (3/12 steps found)
poly(ribitol phosphate) wall teichoic acid biosynthesis II (S. aureus) (3/14 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.187

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7D2 at UniProt or InterPro

Protein Sequence (255 amino acids)

>AMB_RS07265 glycosyltransferase (Magnetospirillum magneticum AMB-1)
MTHIPSILIAGVRVDSPSFAGTLDWTLNRITERSGGYICHLGAHGVVDAQQDAVLARALA
GAALALPDGMPLVWLGRWLGLKSERVYGPDFMRSLLAATGDGRCRHFLFGSTPQVLRDLE
RRIRADYPGATIAGCLSPPFGPSSPEETEAHLHAIRNAGADVVWVGLGAPRQEKWMADVT
ARLPGILLFGVGAAFDFLSGTKPQAPAFVRRSGLEWAFRWLSEPRRLTSRYGRVIPVFLW
LAARELWSRRQNRPV