Protein Info for AMB_RS07225 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details PF08447: PAS_3" amino acids 158 to 242 (85 residues), 49.4 bits, see alignment E=6.8e-17 TIGR00229: PAS domain S-box protein" amino acids 181 to 256 (76 residues), 25.8 bits, see alignment E=5e-10 PF00512: HisKA" amino acids 270 to 334 (65 residues), 41.8 bits, see alignment E=1.3e-14 PF02518: HATPase_c" amino acids 378 to 488 (111 residues), 94.4 bits, see alignment E=9.2e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1430)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7E1 at UniProt or InterPro

Protein Sequence (497 amino acids)

>AMB_RS07225 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MGLAVLRAPDVTAGTIPKPRERIAVRLGLIFAALAAIIAAIMALAVWSLWPDEGDRSLGW
LLAGLVPLLVGLSFWAGMAIGAGADRRLACPTARPSAAGAERWSDPLGLDAALTDLTQRF
EHSLHEVEQRGHALVANAERVAQLGSAERDLSTGTGVWSEEFHTILGLVPGACVPAHDVF
LDVVHPGDRAEVAEILRVVAAEGGRREADFRIIRPDGEVRMLRGCAEVSCDAAGRPVRMD
STIQDITERKRLENELDGLIRELWRSNEELEQFAYVASHDLRQPLRVVGSYVSLLEEELL
DTLGGDSLEYMGFVRDGVRRMDRLITDLLAYSRVGRVIGDAPFAAAEAVESALSDLQIEI
EDCDATLSVAAALPVLYGDRGEMERLFVNLIGNALKYHRPGQPPHVSVECEDQGGEWLFR
VRDNGIGIPPEHAERVFGIFQRLHARDEYEGTGVGLAICKKIVDRHGGAIRVESQSGPGT
VLAFTWPKGAHQPQGDG