Protein Info for AMB_RS07210 in Magnetospirillum magneticum AMB-1

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 28 to 44 (17 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 91 to 118 (28 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details amino acids 172 to 196 (25 residues), see Phobius details amino acids 392 to 430 (39 residues), see Phobius details amino acids 438 to 454 (17 residues), see Phobius details amino acids 466 to 493 (28 residues), see Phobius details amino acids 496 to 497 (2 residues), see Phobius details amino acids 500 to 532 (33 residues), see Phobius details amino acids 561 to 582 (22 residues), see Phobius details PF03600: CitMHS" amino acids 16 to 531 (516 residues), 238.8 bits, see alignment E=1.4e-74 amino acids 483 to 580 (98 residues), 34.2 bits, see alignment E=2.3e-12 PF02080: TrkA_C" amino acids 217 to 278 (62 residues), 37.5 bits, see alignment E=2.7e-13 amino acids 305 to 369 (65 residues), 39.2 bits, see alignment E=7.9e-14 PF00939: Na_sulph_symp" amino acids 437 to 583 (147 residues), 38.4 bits, see alignment E=1.2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1427)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7E4 at UniProt or InterPro

Protein Sequence (584 amino acids)

>AMB_RS07210 permease (Magnetospirillum magneticum AMB-1)
MTFEQGLAFTILVATILMFALDKLRYDLVALLSLSAGVLAGLVPPDKAFHGFSDPVVVVV
AAALVVSAGIERSGIIERLMKPLSALKSPDALIGTLVALVMVLSAFMKNIGALAIFIPLS
VRLARAGGIPVSQILMPLSFASLLGGVMTLIGTSPNIIVSRVRLELTGKAFTMFDFTPVG
VGICLAGIGFLTFAWRVLPRDRQGSSGDKGFRIEDYLAEVRIEAHSPLIGATVADLEQLF
SGGAVTVAAIIRDQGHRYVPGGHWEFSESDVLVLEGDPMALKPLLDQAGLVLMGGGGLGS
EDTTVMEAVVMPNSPLVGSSAVRSAMRRRHGMALLAISRGGRHMIERLRQTEFMAGDVLV
VEGNGEALPGTLAQLGCLPLGQKAMPASGKSAWLPVGIAFAAMLSVAVGVMPVAPAFFLA
AVAMVLLGCLPLRGAYEAIHWPIIILLGALIPISDSMKSTGASDLLAGWLALAASQVPVP
MALGLVLLASMLLAPFLHHAATVLLMGPVAAGMAVKLGLAVDPFLMAVALGAASDFLTPI
GHQCNTLVMGVGGYRFGDYWRLGLPLSVIVLVSGTLLILTFWPI