Protein Info for AMB_RS07120 in Magnetospirillum magneticum AMB-1

Annotation: heme d1 biosynthesis radical SAM protein NirJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 TIGR04051: heme d1 biosynthesis radical SAM protein NirJ" amino acids 25 to 378 (354 residues), 616.1 bits, see alignment E=8.2e-190 PF04055: Radical_SAM" amino acids 31 to 185 (155 residues), 98.6 bits, see alignment E=4.5e-32 PF13353: Fer4_12" amino acids 32 to 134 (103 residues), 30.6 bits, see alignment E=3.9e-11

Best Hits

KEGG orthology group: None (inferred from 71% identity to dar:Daro_3261)

Predicted SEED Role

"Heme d1 biosynthesis protein NirJ" in subsystem Dissimilatory nitrite reductase or Heme biosynthesis orphans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>AMB_RS07120 heme d1 biosynthesis radical SAM protein NirJ (Magnetospirillum magneticum AMB-1)
MFRVSQFMQELVAPSPVGPRRDPPGPVVIWNLIRRCNLACKHCYSISADKDFAGELSTDE
VFGVMKDLKSFRVPVLILSGGEPLLRPDIFDIAIRAKEMGFYTALSSNGTLIDDPIADRI
AEIGFNYVGISIDGIDSTHDRFRARQGAFAESMGGIRRCVKRGIKVGLRFTMTMDNAAEL
PQVVDLMESEGVAKFYFSHLNYAGRGNKNRLDDATMQVTRNAMDYLFDTAWAHAAAGRER
EFVTGNNDADGPYFLSWVQRHHPDKAAHIAAKLVQWGGNASGINVANIDNLGEVHPDTMW
WNHKLGNVRDRPFSAIWPDTSDSLMAGLKARPRPVEGRCAACAHLDMCNGNTRVRAQRVT
GNAWAEDPGCYLSDEEIGLA