Protein Info for AMB_RS07115 in Magnetospirillum magneticum AMB-1

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF22451: NirdL-like_HTH
  • amino acids 10 to 56 (47 residues), 58.2 bits, E=7.4e-20
• PF17805: AsnC_trans_reg2
  • amino acids 67 to 154 (88 residues), 80.4 bits, E=1.3e-26

Best Hits

Swiss-Prot: 53% identical to NIRH_PSEAE: Protein NirH (nirH) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to mag:amb1407)

MetaCyc: 48% identical to siroheme decarboxylase NirH subunit (Paracoccus pantotrophus)
RXN-15805 [EC: 4.1.1.111]

Predicted SEED Role

"Heme d1 biosynthesis protein NirH" in subsystem Dissimilatory nitrite reductase or Heme biosynthesis orphans

MetaCyc Pathways

• heme d₁ biosynthesis (2/3 steps found)
• heme b biosynthesis III (from siroheme) (1/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.111

Sequence Analysis Tools

See Q2W7G4 at UniProt or InterPro

Protein Sequence (160 amino acids)

>AMB_RS07115 Lrp/AsnC family transcriptional regulator (Magnetospirillum magneticum AMB-1)
MSEAKLDPIDRAIVVATQDGLPLVDKPYHDVARQVGVSPDEVMSRMERMLAEGIIRRMGV
VPNHYALGYKFNGMTVWDVADEDIAEAGRRVGELDFVSHCYHRPRHLPDWPYSLFAMIHA
KEKAGADALVERVAEVLGDLSRGHMVLFSSRILKKTGLRL