Protein Info for AMB_RS07115 in Magnetospirillum magneticum AMB-1
Annotation: Lrp/AsnC family transcriptional regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 53% identical to NIRH_PSEAE: Protein NirH (nirH) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: None (inferred from 100% identity to mag:amb1407)MetaCyc: 48% identical to siroheme decarboxylase NirH subunit (Paracoccus pantotrophus)
RXN-15805 [EC: 4.1.1.111]
Predicted SEED Role
"Heme d1 biosynthesis protein NirH" in subsystem Dissimilatory nitrite reductase or Heme biosynthesis orphans
MetaCyc Pathways
- heme d1 biosynthesis (2/3 steps found)
- heme b biosynthesis III (from siroheme) (1/3 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.1.111
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2W7G4 at UniProt or InterPro
Protein Sequence (160 amino acids)
>AMB_RS07115 Lrp/AsnC family transcriptional regulator (Magnetospirillum magneticum AMB-1) MSEAKLDPIDRAIVVATQDGLPLVDKPYHDVARQVGVSPDEVMSRMERMLAEGIIRRMGV VPNHYALGYKFNGMTVWDVADEDIAEAGRRVGELDFVSHCYHRPRHLPDWPYSLFAMIHA KEKAGADALVERVAEVLGDLSRGHMVLFSSRILKKTGLRL