Protein Info for AMB_RS06955 in Magnetospirillum magneticum AMB-1

Annotation: phosphate ABC transporter permease subunit PstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 226 to 253 (28 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details amino acids 301 to 325 (25 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details amino acids 426 to 449 (24 residues), see Phobius details PF12501: DUF3708" amino acids 8 to 175 (168 residues), 123.6 bits, see alignment E=6.6e-40 TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 159 to 452 (294 residues), 260.8 bits, see alignment E=6.8e-82 PF00528: BPD_transp_1" amino acids 244 to 453 (210 residues), 53.3 bits, see alignment E=3e-18

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to mag:amb1374)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7J7 at UniProt or InterPro

Protein Sequence (457 amino acids)

>AMB_RS06955 phosphate ABC transporter permease subunit PstC (Magnetospirillum magneticum AMB-1)
MQTVTLAAILLLISTLAFQLGRKRAFAVASDHPGTLHSLPGYYGWWVALWCGLPAFAILA
LWLVFEPSLIRALVIADLPEALRALPAERIDVIINEVRNAALGHATANPDFAAAAEHYNR
LQQTGFASAVAVTVALALAGATFAYRRVHAELRARPRVERTITVFLVASSTVAIFTTVGI
VLSLLFEALRFFHMVDFVDFLFGLNWSPQMSTRSDQVGSSGAFGMVPLLTGTMLISAISM
VVALPLGLFSAIYMSEYAQPRVRAIAKPALEILAGIPTVVFGFFAVVTVAPAIRAVGGAL
GLNVAAESALAAGFVMGITLIPLISSLSDDVITAVPQSLREGAFGLGATRSETIVQVVLP
AALPGIVGGVLLAVSRAIGETMIVVMAAGLSAKLTANPLEAVTTVTVQIVTLLVGDTEFD
SPKTLAAFALGLMLFGITLGLNVIALHIVQKYREKYD