Protein Info for AMB_RS06930 in Magnetospirillum magneticum AMB-1

Annotation: hopanoid biosynthesis associated radical SAM protein HpnH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 TIGR03470: hopanoid biosynthesis associated radical SAM protein HpnH" amino acids 1 to 318 (318 residues), 536.3 bits, see alignment E=1.1e-165 PF04055: Radical_SAM" amino acids 34 to 184 (151 residues), 68.4 bits, see alignment E=9.1e-23 PF11946: DUF3463" amino acids 195 to 328 (134 residues), 205.6 bits, see alignment E=2.4e-65

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1369)

MetaCyc: 62% identical to adenosyl hopane synthase (Rhodopseudomonas palustris TIE-1)
RXN-13528

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7K2 at UniProt or InterPro

Protein Sequence (383 amino acids)

>AMB_RS06930 hopanoid biosynthesis associated radical SAM protein HpnH (Magnetospirillum magneticum AMB-1)
MAVPLHQSIKIGSYIVKQHLMGNKRYPLVLMMEPLFRCNLTCNGCGKIDYPDAILNSRIS
VADALASIDECPAPVVVMAGGEPLLHREIDQIVEGALARGKIVFVCTNALLLEKKLDSFK
PHKNFTWTVHLDGDREDHDRAVSREGTFDQAVSAIKAAKAAGFQVNINCTLFNNADAERM
AKFFDYTKSIGVGGITLSPGYAYERAPDTEHFLNRRATKELFRKLFRLGKGKKWEFTQSS
LFMDFLAGNQTYQCTPWGNPTRNVFGWQRPCYLLGEGYAKTYKELMDETDWDSYGTGKYE
KCADCMVHSGYEATAVMDTISNPLKAAMVALRGPRTEGPFAPDLPLDNQRPAINNYDELM
AKNLEMLHSEGRANNLHRVSQGS