Protein Info for AMB_RS06905 in Magnetospirillum magneticum AMB-1

Annotation: NAD-dependent dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03466: hopanoid-associated sugar epimerase
  • amino acids 4 to 328 (325 residues), 520.3 bits, E=8e-161
• PF01370: Epimerase
  • amino acids 5 to 231 (227 residues), 138.2 bits, E=1.4e-43
• PF04321: RmlD_sub_bind
  • amino acids 5 to 157 (153 residues), 28.6 bits, E=3.4e-10
• PF05368: NmrA
  • amino acids 5 to 116 (112 residues), 47.4 bits, E=7.6e-16
• PF02719: Polysacc_synt_2
  • amino acids 5 to 115 (111 residues), 32.3 bits, E=2.7e-11
• PF16363: GDP_Man_Dehyd
  • amino acids 6 to 243 (238 residues), 68.6 bits, E=3e-22
• PF01073: 3Beta_HSD
  • amino acids 6 to 219 (214 residues), 87.5 bits, E=3.7e-28
• PF07993: NAD_binding_4
  • amino acids 7 to 59 (53 residues), 24.4 bits, 6.6e-09
  • amino acids 59 to 212 (154 residues), 53.5 bits, E=9.2e-18
• PF13460: NAD_binding_10
  • amino acids 9 to 170 (162 residues), 70.9 bits, E=5.8e-23

Best Hits

KEGG orthology group: K00091, dihydroflavonol-4-reductase [EC: 1.1.1.219] (inferred from 100% identity to mag:amb1364)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• leucopelargonidin and leucocyanidin biosynthesis (2/4 steps found)
• stachyose degradation (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• leucodelphinidin biosynthesis (1/5 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Flavonoid biosynthesis
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.219 or 5.1.3.2

Sequence Analysis Tools

See Q2W7K7 at UniProt or InterPro

Protein Sequence (330 amino acids)

>AMB_RS06905 NAD-dependent dehydratase (Magnetospirillum magneticum AMB-1)
MAGPVLVTGATGFVGAAIVRALLARGEAVRVLARPASDRRNVANLHVEVAEGRLEDAASL
RKAMAGCRVLIHTAADYRIWVPDPAAMMKANVEGTRTLMEAALAEKVERVVYTSSVATLG
HVEGGVADEDTPSDISDKVGPYKQSKFLAEEVVRRMVAEQGLPAVICSPSTPIGPGDVKP
TPTGRMIVEAASGRMPAYVDTGLNIVHVDDVAAGHLLALDKGRIGERYILGGENLTLADI
LNRIAKITGGRPPLMKLPRWPLYPLALGAETWARFFGGEPFVTVDGLKMSRWHMFFSSAK
AERELGYRHRPADEALDAAVEWFKSIGEVP