Protein Info for AMB_RS06815 in Magnetospirillum magneticum AMB-1

Annotation: ribosome biogenesis GTPase Der

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 TIGR00231: small GTP-binding protein domain" amino acids 3 to 125 (123 residues), 75.8 bits, see alignment E=4.9e-25 amino acids 197 to 362 (166 residues), 88.5 bits, see alignment E=6.2e-29 PF01926: MMR_HSR1" amino acids 4 to 120 (117 residues), 99.5 bits, see alignment E=5.7e-32 amino acids 197 to 314 (118 residues), 80.1 bits, see alignment E=6.3e-26 PF02421: FeoB_N" amino acids 4 to 120 (117 residues), 45.1 bits, see alignment E=3.6e-15 amino acids 196 to 361 (166 residues), 48.7 bits, see alignment E=2.8e-16 TIGR03594: ribosome-associated GTPase EngA" amino acids 4 to 453 (450 residues), 541.1 bits, see alignment E=3.3e-166 PF04548: AIG1" amino acids 196 to 298 (103 residues), 30.1 bits, see alignment E=1.4e-10 PF00009: GTP_EFTU" amino acids 196 to 365 (170 residues), 48.6 bits, see alignment E=3.3e-16 PF14714: KH_dom-like" amino acids 372 to 453 (82 residues), 115.8 bits, see alignment E=3.9e-37

Best Hits

Swiss-Prot: 100% identical to DER_MAGSA: GTPase Der (der) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03977, GTP-binding protein (inferred from 100% identity to mag:amb1344)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7M7 at UniProt or InterPro

Protein Sequence (464 amino acids)

>AMB_RS06815 ribosome biogenesis GTPase Der (Magnetospirillum magneticum AMB-1)
MPFTVAIIGRPNVGKSTLFNRLVGKRLAIVHDLPGVTRDRREGRASLLGMEFQVVDTAGF
EDDGGDSIEARMRHQTDMAVAEADVALLLIDSRAGVTPLDRHFADHLRRLPTPVILVANK
CEGKAGAPGLYESYGLGMGEPVAVSAEHGEGMYELFEALRDHAIKAGALTPEGDDPEPEE
PAEGEDGEPDPTRPLTMAIVGRPNVGKSTLGNQLLGQDRLLTGPEAGLTRDAIAVEWEHR
GRRMKLVDTAGLRKKAQIYDAIEKLSVGNTIETIRMSEVVVLVMDAAAILDKQDLTIARL
VVEEGRALVLAINKWDVVDDPQTALKRLKDRLETSLPQARGVATVTLSALTGRGIEKLMD
AVLDTWTKWNRRIPTAQLNRWLEDMIERHPPPALPGGRRYKIRYMTQAKARPPTFVLFAT
RPEQLPESYSRYLVNGLREAFDLPGVPVRLYVRGGKNPYAEKDG