Protein Info for AMB_RS06810 in Magnetospirillum magneticum AMB-1

Annotation: pyrrolo-quinoline quinone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01011: PQQ" amino acids 118 to 149 (32 residues), 21.8 bits, see alignment (E = 1.8e-08) PF13360: PQQ_2" amino acids 127 to 362 (236 residues), 219 bits, see alignment E=1.1e-68 amino acids 377 to 442 (66 residues), 22 bits, see alignment E=1.8e-08 PF13570: PQQ_3" amino acids 137 to 182 (46 residues), 21.1 bits, see alignment 5.2e-08 amino acids 183 to 222 (40 residues), 30.5 bits, see alignment 5.3e-11 amino acids 319 to 356 (38 residues), 23.2 bits, see alignment 1.1e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1343)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7M8 at UniProt or InterPro

Protein Sequence (443 amino acids)

>AMB_RS06810 pyrrolo-quinoline quinone (Magnetospirillum magneticum AMB-1)
MGMTVMTRRIAGVLIAVLALGGCESWLGENKAPPLPGKRISVLSREKMVEPDIGGGLAKI
VLPPPEDNEDWPQAGGYSNHAMHHMLVGDALQRVWKSDAGTGAGKRRRLLGQPIIAEGKI
FTVDASSMVTAFDANTGKRLWRTELTPDDTSEVYTSGGLGYEDGQVFAATGFAQVVALDA
RTGKIDWRQTVSGPLRGSPTVRGGRVFAVTVDNQTHALAAEDGSVLWTHAGIAESAGLLA
GNSPAVDGNMVVVPYSSGELFALRVENGSMIWQDSLSTVRRTENVGALMDIRGRPAIDRG
RVYAISNADMLVCLEERSGRRIWEKEIGGVQSPWIAGDYLYVLTNSNEVLALEAKTGRIV
WVTEMQNWENPKDREGRIVWVGPVLASDRLIVASSDGKLVSLSPYTGDMLGWEEAPAAIS
IAPIIANGTMYFLTDDADLVAYR