Protein Info for AMB_RS06730 in Magnetospirillum magneticum AMB-1

Annotation: nitrate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 PF00005: ABC_tran" amino acids 31 to 170 (140 residues), 121.5 bits, see alignment E=6.2e-39 PF09821: AAA_assoc_C" amino acids 304 to 422 (119 residues), 141.2 bits, see alignment E=3.5e-45

Best Hits

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to mag:amb1324)

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7P7 at UniProt or InterPro

Protein Sequence (452 amino acids)

>AMB_RS06730 nitrate ABC transporter ATP-binding protein (Magnetospirillum magneticum AMB-1)
MADITTSTALLDLRGVRKTFLTPDRRERTVLEGVDFKLEEGEIVALLGKSGSGKSTLLRI
MAGLIKANGGEVKYRGHLMTGPAKGISMVFQSFALFPWLTVEENVELGLEAAGVAKAERE
ERANEAIDLIGLGGYESAYPKELSGGMRQRVGFARALVMRPDVLLLDEPFSALDVLTSET
LREDLLELWDERKIPTKGILLVSHNIEEAVSMADRVLVFSSDPGRVRAEIRVNLPRPRDT
ESAAFRQIVDEVYTLMTANVRGGGLGAAEQLTLGYRLPDTTPGKMAGLLETVAEAPFNGR
ADLPQLAEETELEDDQLFHLFEGLRVLGLARIAAGDIFVTPAGQAFVEADDAVRKDLFAE
ALVKHIPLAAHIRRVLDERKDHRAPEDRFLQELQDYLTDDEAERVLETTITWGRYAEIFD
YDYNAGVLMLPEEVVEEMEAEEEARDESGLRE