Protein Info for AMB_RS06665 in Magnetospirillum magneticum AMB-1

Annotation: LrgB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 190 to 206 (17 residues), see Phobius details amino acids 213 to 238 (26 residues), see Phobius details PF04172: LrgB" amino acids 23 to 235 (213 residues), 273.7 bits, see alignment E=4.5e-86

Best Hits

Swiss-Prot: 46% identical to YOHK_SHIFL: Inner membrane protein YohK (yohK) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to mag:amb1311)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7R0 at UniProt or InterPro

Protein Sequence (239 amino acids)

>AMB_RS06665 LrgB family protein (Magnetospirillum magneticum AMB-1)
MSTDLSSIWIYLSTSPLLGLTSTLIAYQAAMWLFEKGGRSPLLNPILVSVVIIVGFLMAT
GTEYRTYFDGAQFVHFLLGPATVALAVPLYAQMPILRRAWPAILLVILVGAVMAGVSAVA
VAWALGGSEKVLLSLASKSVTIPIAMGITERIGGIPSLTAVMVMLTGIFGAVCGGWILDL
FRVKDQAARGLALGIASHGIGTVRALQMSETAGAFGGLAIGLTGLITAVLVPLLVGLLR