Protein Info for AMB_RS06645 in Magnetospirillum magneticum AMB-1

Annotation: NUDIX domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00052: nudix-type nucleoside diphosphatase, YffH/AdpP family
  • amino acids 6 to 188 (183 residues), 172.7 bits, E=3.3e-55
• PF00293: NUDIX
  • amino acids 49 to 135 (87 residues), 43.8 bits, E=1.3e-15

Best Hits

Swiss-Prot: 40% identical to ADPP_HAEIN: ADP-ribose pyrophosphatase (nudF) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01515, ADP-ribose pyrophosphatase [EC: 3.6.1.13] (inferred from 100% identity to mag:amb1307)

Predicted SEED Role

"Nudix hydrolase family protein YffH" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.13

Use Curated BLAST to search for 3.6.1.13

Sequence Analysis Tools

See Q2W7R4 at UniProt or InterPro

Protein Sequence (202 amino acids)

>AMB_RS06645 NUDIX domain-containing protein (Magnetospirillum magneticum AMB-1)
MDRDRDVEILSKETVFKGYFQVDRYRLRHRTFAGGWSEEMVREVFERGHAVVVLLYDPDR
DKVALIEQFRPGAYAAGWHPWLVECVAGIIEEGEHPDEVARRETREEAGSDPTDMIHIGD
YLVTAGGSSESCKLYCARVDSSIIAGTHGLAHEGEDIRVFVIDPAEALAMCRDGRINNAM
AVLAIQWLIMERDGLRARWLGA