Protein Info for AMB_RS06625 in Magnetospirillum magneticum AMB-1

Annotation: (2Fe-2S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 20 to 77 (58 residues), 31.1 bits, E=1.9e-11
• PF01799: Fer2_2
  • amino acids 88 to 160 (73 residues), 97.4 bits, E=4.4e-32

Best Hits

Swiss-Prot: 48% identical to IORA_BREDI: Isoquinoline 1-oxidoreductase subunit alpha (iorA) from Brevundimonas diminuta

KEGG orthology group: None (inferred from 60% identity to xau:Xaut_4210)

MetaCyc: 48% identical to isoquinoline 1-oxidoreductase subunit alpha (Brevundimonas diminuta)
Isoquinoline 1-oxidoreductase. [EC: 1.3.99.16]

Predicted SEED Role

"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.3.99.16

Protein Sequence (169 amino acids)

>AMB_RS06625 (2Fe-2S)-binding protein (Magnetospirillum magneticum AMB-1)
MAGKPATAAKAKSPAQLSLTVNGTERRAALADGDMPLVYWLREELGLTGTHLGCGKGECG
ACTVLIDGQPARSCRTTLGEAAGKVVTTIEGLGTPEAPHPVQAAFVEEQAAQCGFCTPGM
VVEGAALLARTAQPDLAEVKEALDGHLCRCGSHQRVLKAVMRAGGRDKS