Protein Info for AMB_RS06605 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 190 to 213 (24 residues), see Phobius details PF17200: sCache_2" amino acids 39 to 187 (149 residues), 112.3 bits, see alignment E=9.3e-36 PF08269: dCache_2" amino acids 40 to 188 (149 residues), 95.1 bits, see alignment E=2e-30 PF17201: Cache_3-Cache_2" amino acids 79 to 185 (107 residues), 43.5 bits, see alignment E=1.2e-14 TIGR00229: PAS domain S-box protein" amino acids 277 to 392 (116 residues), 64.3 bits, see alignment E=1.2e-21 PF00989: PAS" amino acids 278 to 381 (104 residues), 49.1 bits, see alignment E=2.4e-16 PF08448: PAS_4" amino acids 278 to 388 (111 residues), 32.5 bits, see alignment E=4.1e-11 PF13426: PAS_9" amino acids 283 to 384 (102 residues), 48.3 bits, see alignment E=4.7e-16 PF08447: PAS_3" amino acids 297 to 379 (83 residues), 28.4 bits, see alignment E=7.2e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 394 to 558 (165 residues), 123.6 bits, see alignment E=6.5e-40 PF00990: GGDEF" amino acids 397 to 553 (157 residues), 138.3 bits, see alignment E=9e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1298)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7S3 at UniProt or InterPro

Protein Sequence (569 amino acids)

>AMB_RS06605 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MIGDLRIGFRLSFTVVILLAALAGVSAYALHEIRDRLLTERQSQSRVMVRGAISQIARFE
DLERNGSLGREQAQSEAIRAVNSLYFGPDLYVWINDSRPVVLAHPVQAIIGRDVGDIRDA
DGRPLFREFLRLSAASGHGTVTYRWPRVNDDVPRLKISYVEGFAPWDWTVGAGAYVDDID
AAYDEAARRFGLFALLAGLAAALVAWLVGVGITRPLKQVTRCMTRLAAGESVEVPQPARG
DEMGDLMRALGDFKRHLSEKEQFREAHDSVLREAGTVFNLISDAVMVTDRRNHIKLVNPA
FTRITGFAPDEVIGRSPSILSSGRHDKAFYAAMWEQLSSGGSWSGEVWNRAKSGEVFPEW
LSIVAIRDRAGEAHGYVATFSNIAERKRRETRMRWQAEHDALTGLANRVHFETALAVALS
QARQTGSELAVLFISLEGFKEVADTLGRAIGDPVLSVMAKRLRQIVRADDVVARLGGDEF
AVIIPMLQHEGNARFVAGKIVSCLAEPVILGNTQAQISANVGVAIHPHHGTSPKELLSAA
DHAIRCSKQAGRSGIAMAEAAPSSAIRAS