Protein Info for AMB_RS06530 in Magnetospirillum magneticum AMB-1

Annotation: lysine-2,3-aminomutase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03822: lysine-2,3-aminomutase-related protein
  • amino acids 7 to 322 (316 residues), 478.7 bits, E=8e-148
• TIGR00238: KamA family protein
  • amino acids 23 to 311 (289 residues), 264.6 bits, E=1.1e-82
• PF04055: Radical_SAM
  • amino acids 101 to 245 (145 residues), 39 bits, E=9.7e-14
• PF12544: LAM_C
  • amino acids 291 to 322 (32 residues), 30.7 bits, 3.3e-11

Best Hits

KEGG orthology group: K01843, lysine 2,3-aminomutase [EC: 5.4.3.2] (inferred from 100% identity to mag:amb1284)

Predicted SEED Role

"Lysyl-lysine 2,3-aminomutase"

MetaCyc Pathways

• L-lysine fermentation to acetate and butanoate (4/10 steps found)
• superpathway of L-lysine degradation (10/43 steps found)

KEGG Metabolic Maps

• Lysine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.3.2

Sequence Analysis Tools

See Q2W7T7 at UniProt or InterPro

Protein Sequence (344 amino acids)

>AMB_RS06530 lysine-2,3-aminomutase-like protein (Magnetospirillum magneticum AMB-1)
MSSRRTLRTAQDLHDAGLIPSVEAVAGVAEAYAVALTPAVVDLIDPADPADPIARQYVPS
AEELVTTPEELADPIGDAAYSPVKGLVHRYPDRVLLTPLLVCPVYCRFCFRRARVGDGDA
TMTEAEIDTALAYVAGRPEIREVILTGGDPLMLPPPRLAALLGRIGAIAHVELIRIHSRV
PVSDPERVTPDLARVLGGGDKPVWLAVHVNHPHELSPLARGGLERLARTGVPLLSQTVLL
KGVNDSVSVLDELFRALVRNRVRPYYLHHPDLAPGTSHFRPTIEEGQALMRSLRGRLSGI
AQPTYVLDIPGGAGKVPVGPQYWDGEAGTVADPGGRLHDYAERA