Protein Info for AMB_RS06510 in Magnetospirillum magneticum AMB-1

Annotation: phosphoglycolate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF00702: Hydrolase" amino acids 56 to 234 (179 residues), 106.9 bits, see alignment E=3.6e-34 PF12710: HAD" amino acids 58 to 227 (170 residues), 47 bits, see alignment E=8.2e-16 PF13419: HAD_2" amino acids 58 to 239 (182 residues), 118 bits, see alignment E=1e-37 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 58 to 268 (211 residues), 192.9 bits, see alignment E=7.6e-61 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 132 to 238 (107 residues), 37.9 bits, see alignment E=2.9e-13 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 155 to 234 (80 residues), 31.3 bits, see alignment E=3.8e-11 PF13242: Hydrolase_like" amino acids 197 to 263 (67 residues), 39.3 bits, see alignment E=9.8e-14

Best Hits

Swiss-Prot: 41% identical to GPH_PSEF5: Phosphoglycolate phosphatase (PFL_5630) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 41% identity to pfl:PFL_5630)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>AMB_RS06510 phosphoglycolate phosphatase (Magnetospirillum magneticum AMB-1)
MRVPMPAARTMTASLLEAMMRAGPNLLRLWPEGATKGPSGPSQSLFRKVSMGMGLQAVLF
DLDGTLIHSLPDLVAAVNRLLASEGRGALDDRTVMSFVGDGAGTLVMRAFTATGGMPGPK
VEPYLDRFLADYEPRSAESTRPWPGVPETLADLKAAGLTLAVCTNKPSRATAEILAALDL
GRWFDLVVGADDAPAIKPDPAHVTCILDRLGVAADRAVMVGDSANDIVSARAAGVRSVAL
SFGYCHGPVAELGADWVIDDFRQLSPLLLGRRPPVS