Protein Info for AMB_RS06405 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 58 (18 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 293 to 310 (18 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1262)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7V9 at UniProt or InterPro

Protein Sequence (348 amino acids)

>AMB_RS06405 hypothetical protein (Magnetospirillum magneticum AMB-1)
MISVTARRLPLLMAGALSLAAGIIAGEGRLGWPVGGADLALVHGPLMICGFFGTVIGLER
AVALGKAWGYGSPLFTALGGVALIAGHPWAGAVLLLAGSLVFVAMSLAVILRQREIFTTV
LGLGGLAWAAGNLLWSLGGDAAGSVPLWAAFLVLTIAGERLELSRFLPPWRWRTPTLLPP
LLVLLAGMGLGSWPVFGAGLALLTLWSVVNDVVRRTIRQAGLTRYVAVCLLSGYAWALAA
GLLMLRLSPGETGIVYDAALHALFVGFVFAMVFGHAPVILPAVLRVAVPYKPVFYLPLAA
LHASLGLRMAGDLADIHAVRQWGGMLNAVAIALFIVTMLVTVLRARKR