Protein Info for AMB_RS06390 in Magnetospirillum magneticum AMB-1
Annotation: cytochrome c
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 71% identical to CYC22_PHAMO: Cytochrome c2 iso-2 from Phaeospirillum molischianum
KEGG orthology group: K08738, cytochrome c (inferred from 100% identity to mag:amb1259)MetaCyc: 40% identical to cytochrome c2 (Agrobacterium fabrum)
Predicted SEED Role
"Cytochrome c2" in subsystem Soluble cytochromes and functionally related electron carriers
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2W7W2 at UniProt or InterPro
Protein Sequence (121 amino acids)
>AMB_RS06390 cytochrome c (Magnetospirillum magneticum AMB-1) MLNTKKLGLVLGAALLAAPFAASAADAPAAFNQCKACHKVEAGKHGVGPSLFGVYGAKAG HAEGYKYSDNHVKSGMVWDDANLGKYLADPKATIPGNKMAFAGLKKPEDVAAVVAYLKTL K