Protein Info for AMB_RS06305 in Magnetospirillum magneticum AMB-1

Annotation: 4Fe-4S dicluster domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF13247: Fer4_11" amino acids 52 to 110 (59 residues), 44.4 bits, see alignment E=8e-15 PF12797: Fer4_2" amino acids 82 to 102 (21 residues), 29.9 bits, see alignment (E = 1.7e-10) PF13237: Fer4_10" amino acids 83 to 169 (87 residues), 31.6 bits, see alignment E=6.7e-11 PF00037: Fer4" amino acids 84 to 105 (22 residues), 31.1 bits, see alignment (E = 7.6e-11) PF12837: Fer4_6" amino acids 85 to 104 (20 residues), 29.9 bits, see alignment (E = 1.9e-10)

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1242)

MetaCyc: 63% identical to phenylacetyl-CoA:acceptor oxidoreductase subunit gamma (Thauera aromatica)
Phenylacetyl-CoA dehydrogenase. [EC: 1.17.5.1]

Predicted SEED Role

"Fe-S-cluster-containing hydrogenase components 1" in subsystem Anaerobic respiratory reductases or Hydrogenases

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7X9 at UniProt or InterPro

Protein Sequence (217 amino acids)

>AMB_RS06305 4Fe-4S dicluster domain-containing protein (Magnetospirillum magneticum AMB-1)
MTKWAIVADLGRCVGCQTCTTACRHANATPPGVQYRKVLDMEVGTFPDVRRVFVPVGCMH
CDEPPCRDVCPTTATTKRADGMVMIDYDICIGCGYCIVACPYQARYKVSKPTFAFKDQET
QNERTRFDERLLGVAQKCTFCVDRVDYGLANGLTPGVAPEATPACVNSCLSKALTFGDTD
NPDSNVSKLLKRYKSFRMHEELGTGPNIHYLWETEDE