Protein Info for AMB_RS06280 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 88 (35 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 154 to 186 (33 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 399 to 419 (21 residues), see Phobius details amino acids 425 to 444 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1237)

Predicted SEED Role

"FIG00780717: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7Y4 at UniProt or InterPro

Protein Sequence (475 amino acids)

>AMB_RS06280 hypothetical protein (Magnetospirillum magneticum AMB-1)
MARVPLTGRKLAYHALTFVLVVLLLMAPALWNGYPLVYFDSEDYVEMAFSFQPIIWRIMT
YGMFCSIARFFGTLWALPLVHAILTTWVLHEAVMGFIGRWRHMVFLGVGLALALFTGLPW
VSSQLLADVFAGVAILGIAALAFGEGLQPWRRFALVVITAIAICVHMSHVAVAAGLLLVL
VTVWLGSRFMLRMPRPRLTAPVMAIVAGILLVPVTHYFIMGRFVFSESGQVLQLALLVQN
GMAKKYLDEVCPKGADLEMCDHKDELPHTADEFLWGDSPFDEMGGWKALHDEAGQIVSGA
IRLFPADMLNSALANTWEQLNSIESGEDLVPMTWHFVRTQLRRYPDEFRQFRFARQQRRP
AIDFFTINSFQIPINWGAELLTPILLVVAWRRRDRTTTGLAIIVVAAIIGNAIVCGALSN
PHDRYQNRVVWLALFTAMVGAVRLDQRFAGQRRLSIRAENEALAAEAAEGKTPPA