Protein Info for AMB_RS06180 in Magnetospirillum magneticum AMB-1

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 187 to 208 (22 residues), see Phobius details PF08269: dCache_2" amino acids 35 to 188 (154 residues), 110.9 bits, see alignment E=1.7e-35 PF17200: sCache_2" amino acids 40 to 185 (146 residues), 113.7 bits, see alignment E=1.9e-36 PF00672: HAMP" amino acids 207 to 256 (50 residues), 37.8 bits, see alignment 4.9e-13 PF00015: MCPsignal" amino acids 367 to 522 (156 residues), 101.4 bits, see alignment E=1.3e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1217)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W804 at UniProt or InterPro

Protein Sequence (565 amino acids)

>AMB_RS06180 methyl-accepting chemotaxis protein (Magnetospirillum magneticum AMB-1)
MLGKSGILLKLMTTAVLALVGFAILSAVALTQLRQSMLNDRIEKVAALAEVARGTLKSFH
DRAKAGEFDEATAKAQAIETLRPLRYQGDEYFFIYDFDGVNVLHPVRPEREGKNFIDSKD
ADGKAYIRGMIEGSKTGRAVEFYKFPRPGSDAPVPKVSVALSHAPWKLMVGTGIYIDDID
TAFNAAALRFAGIALVVCLVALGLVTVLSRDIAAPLRRLAEVAQRLARQDYSAQVEKTER
KDEIGLLIAAVAVLRDEAASAAEARAAQQESYRTASIQRKQARLQLADDIESSIKRVTDV
VVQAVGEMESAAAIVSGAVGEAGAKAGAAASSAEQASGNVATVAAAAEQLSASISEISRQ
VHESSDTSGRAVAEAERTNALVQGLAEAAGHIGEVVTLINDIAGQTNLLALNATIEAARA
GEAGKGFAVVAGEVKHLATQTAKATDEIYNQVNTVQARTREAVDAIASIAATIGRINEIA
GAIAAAVEEQGAATAEIARNVQQASAGTQEVSSAMGSLAAATASAGSSADSVQGIAKRLT
SEAQALDREVHQFMVSMRSDQGAES