Protein Info for AMB_RS06160 in Magnetospirillum magneticum AMB-1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 336 to 358 (23 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 343 (313 residues), 116.6 bits, see alignment E=6.2e-38 amino acids 216 to 393 (178 residues), 44.3 bits, see alignment E=6e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1213)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W808 at UniProt or InterPro

Protein Sequence (400 amino acids)

>AMB_RS06160 MFS transporter (Magnetospirillum magneticum AMB-1)
MSSAVSQRSARASLAFSCAGHAYAHIFEPIFFIVALFLPAETGLSYEEVLALIVAGKLLY
GLPAPLAGWLGDRWSTVGMMAVYFIGLGAAAIAVGLSHGPVMLAVALGFMGLFGSIYHPV
GISWLVRNAVDKGKAIGLNGVFGGVGPALAGVVAGGLIALSGWRAAFILPGMVVLGTGLL
FLVMVARGVVVENKQDRKPEPVADRGETVRAGIVLSVTMLCAGLVYQATQPSLPKLFEER
LGEFGLWAAAGGVTVVYLLAGLTQILAGHLADRISPKRIYLLAALIQVPLLLGLAHASGP
GLLLVAVLAVSFNMAGIPAENLLLSRYTPAKWRGTAFGLKFVLSFGVSGLGVPMVSLIRG
AGGGFETVFTVLAVSAGLVALAAWQLPGERGRTAVPAAAE