Protein Info for AMB_RS06150 in Magnetospirillum magneticum AMB-1

Annotation: HD-GYP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details PF13487: HD_5" amino acids 222 to 387 (166 residues), 132.3 bits, see alignment E=1.6e-42 PF01966: HD" amino acids 235 to 355 (121 residues), 63.7 bits, see alignment E=1.9e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1211)

Predicted SEED Role

"Response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W810 at UniProt or InterPro

Protein Sequence (428 amino acids)

>AMB_RS06150 HD-GYP domain-containing protein (Magnetospirillum magneticum AMB-1)
MPAEASLNRQLALRLGVGGLAIAIILGAATFIYEMRRIDAPFVEEAVEQARTLSTQLPPR
LDSTTRTEVKARLSAFLKERRGAADHFAGAEIYTAEKTALAEAMAEDNGMLAQAVDRSRH
VFPEPGETWYTKHIVGGELYLLVLTGLTAPDNSRLGYFEGVYHVSRIRVAGASRAGLRTS
ILVILSVLATSGLLFPVIKRLNRSLVERSRSLLHANLGAIEMLGNAIAKRDSDTSSHNYR
VTLYALRLAEALRLDAAHIRSLLKGAFLHDVGKLAIPDAILLKPGKLDDAEFAIMKTHIT
HGLDLVQRFAWLKDAAAVVGHHHEKYDGSGYMAGLAGDQIPLAARIFAIADVFDALTSKR
PYKEAFPVAQATAIMAAGRGSHFDPALLGLFFSMAGDLYGEFGGREDDGLKHTLRVRTLH
YFEEALER