Protein Info for AMB_RS05740 in Magnetospirillum magneticum AMB-1

Annotation: helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 26 to 43 (18 residues), see Phobius details PF21984: DnaD_N" amino acids 38 to 132 (95 residues), 43.6 bits, see alignment E=5.8e-15 PF03428: RP-C" amino acids 42 to 161 (120 residues), 37.1 bits, see alignment E=6e-13 PF13730: HTH_36" amino acids 50 to 104 (55 residues), 54.5 bits, see alignment E=1.7e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1130)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W891 at UniProt or InterPro

Protein Sequence (168 amino acids)

>AMB_RS05740 helix-turn-helix domain-containing protein (Magnetospirillum magneticum AMB-1)
MSDVQETAKVIPLRPAKAAKASEAKWGTAVMNMGFAIIPSLLLRAQQRLGLNPTQLAVLL
QLCDYWWDEKRKPFPSKEALSQRLGLSTRQVQRHIADLEKADLVKRIERIGRHGGKLSNT
YDLSGLVKRLQALEPEFRQVEEENRQRREEVGQPRHRRRIIGRIDPTP