Protein Info for AMB_RS05675 in Magnetospirillum magneticum AMB-1

Annotation: Serine phosphatase RsbU regulator sigma subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 PF00072: Response_reg" amino acids 161 to 272 (112 residues), 93.2 bits, see alignment E=1.2e-30 PF07228: SpoIIE" amino acids 340 to 531 (192 residues), 177 bits, see alignment E=4.4e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1116)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8A5 at UniProt or InterPro

Protein Sequence (537 amino acids)

>AMB_RS05675 Serine phosphatase RsbU regulator sigma subunit (Magnetospirillum magneticum AMB-1)
MAVTAFDRRLEAIAERVQAVVGPAARSIRASAATLAADSSTAAFADEIGEIDNAAALLVE
MVAGCRPELDDDGSIETACSRLRHDLRTPLVALKGYGELVQEIAAEEGLEAVSAALGPLL
EGVAEVMVAIERALPALSRAMAAEEAEDDGPDLVTYPAGRVLVADDSKANRDVLVRYLSR
EGHQVVAVADGLAAVEAVFGQAFDLVLLDMIMPGMNGDEVLKAIKADSRLRSLPVIMISA
LDGLDSIVRCIEAGAEDYLPKPFNRVLLRARIGACLEKKRLREVELSYLQALEKELTIAR
EVQRSILPKVFPPHSSLAGHGLMDPAREVGGDFYDFFALDGDRIGIAVGDVSGKGVPAAV
YMAMVRTQLRATALFGLSPAECLGRLNDHLSADNPEGMFVSLFYGIMDCATGVFTYANGG
HNWPVVLRAEGGVEWVAGTNDLLVGVMGGSDYHDAALALAPGDSLFVYTDGVVEAIDPAE
AEFGKTGLVAVLEGLAHLAPAALCDGVLAAVRAFEGGQPHSDDLTCVAVRFLGPVRN