Protein Info for AMB_RS05650 in Magnetospirillum magneticum AMB-1

Annotation: hybrid sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 687 PF00989: PAS" amino acids 54 to 174 (121 residues), 32.3 bits, see alignment E=2.7e-11 PF08448: PAS_4" amino acids 61 to 183 (123 residues), 36.9 bits, see alignment E=1.1e-12 TIGR00229: PAS domain S-box protein" amino acids 64 to 188 (125 residues), 58.9 bits, see alignment E=2.8e-20 PF13426: PAS_9" amino acids 66 to 181 (116 residues), 49.3 bits, see alignment E=1.5e-16 PF00512: HisKA" amino acids 202 to 270 (69 residues), 71.6 bits, see alignment E=1.4e-23 PF02518: HATPase_c" amino acids 317 to 425 (109 residues), 104.8 bits, see alignment E=1.1e-33 PF00072: Response_reg" amino acids 448 to 556 (109 residues), 70 bits, see alignment E=5.8e-23 amino acids 568 to 674 (107 residues), 85.4 bits, see alignment E=9.5e-28

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to mag:amb1112)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8A9 at UniProt or InterPro

Protein Sequence (687 amino acids)

>AMB_RS05650 hybrid sensor histidine kinase/response regulator (Magnetospirillum magneticum AMB-1)
MTDRIAELVAENALLRGEIRVAREAAEITARLVVKQFEETERLLDRFQSANAQRQAVLDA
ALQMSIIATDMNGKVLLFNRGAETLLGYASDEVVGQSTLLDFLLPEEVAAHADELAAELG
HAVSPETLFAEYVRHGLISAREWTYRRKDGTRFPVSLSITPLKGGDGGLAGTLAAAMDIT
ERKWAEEEAHRAKQAAEAANQAKSSFLANMSHELRTPLNAIIGYSEMLQEEMEDLGQDDL
IPDLAKIHSAGRHLLTLINDVLDISKIEAGKMDLFVEAFEIAPMVADVVATISPLIQKNG
NTLVVDGAGEIGAMEADLTKVRQTLFNLLSNASKFTSDGTITLSTRRQGEWIEFAVADTG
IGMAPAELDRLFQAFSQADASTTRKFGGTGLGLAISRTFCRMMGGDIAVASEPGRGTTFT
VRLPAVSASPKAARPAGAIESGPELPLVLVIDDDAVARDLLGRFLDENGFRARFAADGPL
GLEMARALRPAAITLDVMMPGMDGWSVLTALKTDPELAAIPVIMVSVVENQALGYALGAH
HFMSKPIDRDQLAEVLSRFKEAGPIERILVVEDDHTNREMLRRMLVKEGWSVIEAANGRI
ALERVAESRPDLILLDLMMPEMDGFEFVSELRRHSAWHAIPVVVLTAKDIGQDDRDRLAG
GVQKVLQKGAADNETLLTELKRLVTPG