Protein Info for AMB_RS05435 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 106 to 135 (30 residues), see Phobius details amino acids 141 to 167 (27 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 205 to 220 (16 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details PF01061: ABC2_membrane" amino acids 13 to 221 (209 residues), 58.7 bits, see alignment E=3e-20

Best Hits

KEGG orthology group: K09690, lipopolysaccharide transport system permease protein (inferred from 100% identity to mag:amb1063)

MetaCyc: 36% identical to O:9 antigen ABC transporter permease component (Escherichia coli O9a)
RXN-22100 [EC: 7.5.2.14]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8F8 at UniProt or InterPro

Protein Sequence (262 amino acids)

>AMB_RS05435 ABC transporter permease (Magnetospirillum magneticum AMB-1)
MESRPALIFIGLVWARAKADFGSRYAGSALGTLWNALQPILTIAVFSAVFETILRVRLPK
GDLPFGYTLYLCAGYFPWLAFSESMTLGAGAFLRNAQFIRKMPVPAYLFVADVVLTSFIF
LAVNFAIFLLLSIFAGNPVSLTWALIPIIFLVLWVYTYCLGLIVGLVNTYFRDVGLAVPI
ILQLWMWMTPIVYPIEAVPESFQKLLMINPLTPVLAMLRDATLNGRMPARHDLTLTALWT
IVLIALATLAWRRLGRDVRDLL