Protein Info for AMB_RS05410 in Magnetospirillum magneticum AMB-1

Annotation: HEAT repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF13646: HEAT_2" amino acids 36 to 120 (85 residues), 39.1 bits, see alignment E=2.6e-13 amino acids 99 to 179 (81 residues), 33.6 bits, see alignment E=1.4e-11 amino acids 161 to 230 (70 residues), 38.1 bits, see alignment E=5.5e-13 amino acids 224 to 307 (84 residues), 56.3 bits, see alignment E=1.1e-18 PF03130: HEAT_PBS" amino acids 175 to 201 (27 residues), 14.5 bits, see alignment (E = 1.5e-05) amino acids 237 to 262 (26 residues), 15.9 bits, see alignment (E = 5.6e-06) amino acids 268 to 294 (27 residues), 30 bits, see alignment (E = 1.5e-10)

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1058)

Predicted SEED Role

"HEAT repeat-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8G3 at UniProt or InterPro

Protein Sequence (311 amino acids)

>AMB_RS05410 HEAT repeat-containing protein (Magnetospirillum magneticum AMB-1)
MPDPEIAALTAALDQPDPDIRRIAVMQAADWAHDHPGLFAQASRDDDVGVRLEAVKALDG
DASEDGVNALADRLEDAEAEIRAAAAESLAEILDEAAGPALLARLEGARGEARAAILAGL
RKLRQEGALEPALDALGDPLASVRLEAVRVLGYLRHHRAVAGLAERVVVDGDAEVRRAAV
GALGFAPPDAAAPALLRALGDADWQTREEAAVTLGKLLPAEAADGLIVALEDQYWQVRQK
AAVALGRLRAGAAVPALIAQLSHVIGNLRREAAGALAAIGDPAAVPALTEALNDADVEVR
KSARRALDALA