Protein Info for AMB_RS05340 in Magnetospirillum magneticum AMB-1

Annotation: IS3 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 PF13276: HTH_21" amino acids 36 to 89 (54 residues), 52 bits, see alignment E=1.7e-17 PF24764: rva_4" amino acids 111 to 227 (117 residues), 32.8 bits, see alignment E=1.5e-11 PF00665: rve" amino acids 113 to 208 (96 residues), 85 bits, see alignment E=9.6e-28 PF13683: rve_3" amino acids 197 to 262 (66 residues), 61.4 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: K07497, putative transposase (inferred from 100% identity to mag:amb4429)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>AMB_RS05340 IS3 family transposase (Magnetospirillum magneticum AMB-1)
MIEPKHPALSIGAQCHLLSIARSSFYYEPLGETEANLELMRLIDRQFLETPFYGVRQMAW
HLQNEGHPVNVKRVRRLMRLMGLMPIYQKPNTSKPAKGHKTYPYLLRGLRIDRPNQVWCA
DITYLPMRRGFLYLIAIMDWATRKVLAWRISNTLEADFCVEVLNEAILRFGPPEIMNTDQ
GSQFTSFAWIDRLKRAGTRISMDGKGRCIDNVFIERLWRSLKYECVYLHAWETGSQARAG
IGPWITFYNHKRPHAAHGGRTPAVVYWNTINQTDQQARRVA