Protein Info for AMB_RS05245 in Magnetospirillum magneticum AMB-1

Annotation: ferrous iron transport protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 704 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 293 to 315 (23 residues), see Phobius details amino acids 346 to 374 (29 residues), see Phobius details amino acids 392 to 415 (24 residues), see Phobius details amino acids 426 to 452 (27 residues), see Phobius details amino acids 458 to 478 (21 residues), see Phobius details amino acids 516 to 534 (19 residues), see Phobius details amino acids 606 to 627 (22 residues), see Phobius details amino acids 647 to 669 (23 residues), see Phobius details amino acids 675 to 696 (22 residues), see Phobius details PF02421: FeoB_N" amino acids 6 to 159 (154 residues), 180.7 bits, see alignment E=3.7e-57 PF01926: MMR_HSR1" amino acids 6 to 117 (112 residues), 66.4 bits, see alignment E=6e-22 TIGR00437: ferrous iron transport protein B" amino acids 11 to 671 (661 residues), 560 bits, see alignment E=3.6e-172 PF17910: FeoB_Cyto" amino acids 177 to 267 (91 residues), 70 bits, see alignment E=4.7e-23 PF07670: Gate" amino acids 356 to 451 (96 residues), 77.2 bits, see alignment E=3.1e-25 amino acids 518 to 674 (157 residues), 71 bits, see alignment E=2.6e-23 PF07664: FeoB_C" amino acids 460 to 511 (52 residues), 65 bits, see alignment 1e-21

Best Hits

KEGG orthology group: K04759, ferrous iron transport protein B (inferred from 100% identity to mag:amb1024)

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8J7 at UniProt or InterPro

Protein Sequence (704 amino acids)

>AMB_RS05245 ferrous iron transport protein B (Magnetospirillum magneticum AMB-1)
MKSPVTVALVGNPNAGSTSLFNALTGAQSAVANYQRVTTSLNVREITHGGVPLRIVDVPG
IFSTSSQSPEEKVGCDYIHGEEPDIIVNVLDAGHLDRSLFLTTQLIETGLPRITVLNMMD
EVRRAGIRIDTALLASALGSPVVETCALKKEGIDALLDAVAAMASTTPAAAPLRLHYDSH
LEAAIERVQQHLSKLHPQELSPVRSRWLAIKMLEGDDEVLRHESNHVELVEEIKGEQSAL
AHEHDEDTASLLASARFAFSNGLLREVRQQDGDPTAGFKLTRILDDFFLNRTLGLPLLLG
ILWVMFEATFTLGAIPTDWIKAGVQLATDLVDKTLPEGMFHDLVVNGVMAGVGGTIVFLP
NIVILFFFMAILSGTGYLARASFLMDRVMHHFGLHGTTLIPMVAGFGCNVPAVMATRVIT
NKRARLIAMLIAPFMNCSARLPVFILFAGAFFADIAGTVVFGIYMLSLAAAMLSAVLLNR
IIPGSGGDAFVMELPPYRLPTLHSVLHHMWDSAQGFVAKVTGVILVGSIVIWFLQEFPRD
ITYSQDFETVIAEQTALPDSPEKETALKTLKSAQAQEKLEKSYLGRSAIAVTPLFQPLGF
SWRDSAAIMTGFVAKEVVVATYAVIYAQEKGSDQLTETLRGAMPPATAIAFMIFTLLYAP
CLSTIAIIGKEAQSWRWAGFSVAYSLTFAWLLALAASRIGGTFL