Protein Info for AMB_RS05205 in Magnetospirillum magneticum AMB-1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 644 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 369 to 391 (23 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 445 to 464 (20 residues), see Phobius details amino acids 484 to 501 (18 residues), see Phobius details amino acids 518 to 540 (23 residues), see Phobius details amino acids 553 to 570 (18 residues), see Phobius details amino acids 591 to 608 (18 residues), see Phobius details amino acids 614 to 630 (17 residues), see Phobius details PF07690: MFS_1" amino acids 32 to 386 (355 residues), 80.9 bits, see alignment E=8.6e-27 amino acids 283 to 577 (295 residues), 39.7 bits, see alignment E=2.9e-14 PF01794: Ferric_reduct" amino acids 486 to 598 (113 residues), 61.4 bits, see alignment E=8.7e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1016)

Predicted SEED Role

"Magnetosome protein MamZ, permease @ Magnetosome protein MamH / FIG001196: Membrane protein YedZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8K5 at UniProt or InterPro

Protein Sequence (644 amino acids)

>AMB_RS05205 MFS transporter (Magnetospirillum magneticum AMB-1)
MPRNAEAPAKGTTADDFAPTQWNIIYLLMTVGALMAALSISIQPLLLDKIFGIAFEKEGA
VNADIQVVAEIVSIVCVGWFGLLSDRIGRVRIIALGFLIAVVGAAVSLLSLQVGLAFGAA
GLVLFYLTRVLLTVGADTVQLQLSTLVGDVSSRANRPRLMGNLVFMMVFGGTMLAAIVMQ
MADYPGGVFLIMCLPLLAGIAGFQLTRRNLRDVAPPQPASEDDEHPLRQVWTVITSDPRM
QLAFAAAFYTRADVIILSLFFSLWCISVSDLVGVTRTFATAHAAVMIGLLGLAVLAAVPL
WRSFIERHSRISAIGASLSLAALGYIWLGMFANPFNWLVALPLLMVGIGHAGCFVTLQVL
TVDASPKPILGAMVGAGYLVGGLGTVMLVQSGGYYFDALGPRAPFILMGTGKMLVTLYAA
WLLANGIDETCDHHLKSARTVDWKPLVFLTAALPFVWLVGRSVIEGYISNGSLGEAPVGF
VNRYLGDWAFTFLIISLAMRPVQEITGIKTLAKYRRMIGLFAFFYAVMHVLAYVALEWAL
NLGDMMGDIYKRPFILLGLVAFALLIPLAFTSANSQIKRIGGKRWKKLHSATYVINALVA
LHFILAANHENGEPYVYAAAVIVLLWYRFHQWRGGNVLRALRIG