Protein Info for AMB_RS05195 in Magnetospirillum magneticum AMB-1

Annotation: YnfA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 48 (18 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details PF02694: UPF0060" amino acids 6 to 107 (102 residues), 106.2 bits, see alignment E=5.4e-35

Best Hits

Swiss-Prot: 100% identical to Y1014_MAGSA: UPF0060 membrane protein amb1014 (amb1014) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K09771, hypothetical protein (inferred from 100% identity to mag:amb1014)

Predicted SEED Role

"Protein of unknown function UPF0060"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8K7 at UniProt or InterPro

Protein Sequence (108 amino acids)

>AMB_RS05195 YnfA family protein (Magnetospirillum magneticum AMB-1)
MWAIPTYLLAAFAEIGGCFAFWAWLRLGKSPFWLAPGMASLALFAWALTRVDADFAGRAY
AAYGGIYILSSLVWMWAVEESPPDRWDVLGAAFCLAGALVIIFAPRGE