Protein Info for AMB_RS05190 in Magnetospirillum magneticum AMB-1

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 126 to 150 (25 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 24 to 313 (290 residues), 217.4 bits, see alignment E=1.2e-68 PF01545: Cation_efflux" amino acids 29 to 238 (210 residues), 121.7 bits, see alignment E=1.8e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1013)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8K8 at UniProt or InterPro

Protein Sequence (318 amino acids)

>AMB_RS05190 cation transporter (Magnetospirillum magneticum AMB-1)
MHVHNLSSWQHSHHFQSGLEASAERRTKIVVALTIVMMVAEIAAGTIFNSMALLADGWHM
STHAGALGIAAFAYTFARSHADDQRFTFGTGKVGTLGGFTSAIILCMVALLMVWESANRL
MTVQAIAFDEALMVAVIGLVVNVVSAGILGGHGLGDDHDHCGHHHDHDHHRDHHDHNLQA
AYIHVLADVLTSVLAIAALLLGKYLGWWWMDPMMGLVGAAVIGKWAWGLMRKTGSVLLDH
SDDRELPEEVRAAIEGDADNRLSDLHLWQIGPGHWGAIVSLVTHTPREPGHYKTLLAEVH
ELSHVTVEVHPCDGASCG