Protein Info for AMB_RS05165 in Magnetospirillum magneticum AMB-1

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 163 to 191 (29 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 11 to 282 (272 residues), 215.1 bits, see alignment E=6e-68 PF01545: Cation_efflux" amino acids 15 to 207 (193 residues), 155.5 bits, see alignment E=1.5e-49 PF16916: ZT_dimer" amino acids 213 to 283 (71 residues), 38 bits, see alignment E=1.4e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1007)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>AMB_RS05165 cation transporter (Magnetospirillum magneticum AMB-1)
MKFENCRDCREEVVWWAFTADICMTLFKGVLGLMSGSVALVADSLHSGADVVASGVTQLS
LKISNKPADERYPFGYGNIQYISSSIVGSLLLIGASFLMYGSVMKLISGTYEAPSIFAAV
GASVTVIVNELMYRYQICVGNENNSPAIIANAWDNRSDAISSAAVMVGVIASVIGFPIAD
TIAAIGVSALVGRIGLELIGTSIHGLMDSSVDTELLQTAWQVAMDTPMVHSIYFLRGRHV
GEDVQFDIRLRVDPNLRIKDSSMVAEAVRRRIQEEIPHARDIRLFVSPAPAAAARA