Protein Info for AMB_RS05140 in Magnetospirillum magneticum AMB-1

Annotation: PDZ domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details PF00089: Trypsin" amino acids 154 to 321 (168 residues), 59.3 bits, see alignment E=1.5e-19 PF13365: Trypsin_2" amino acids 156 to 295 (140 residues), 106.9 bits, see alignment E=4.8e-34 PF18509: MCR" amino acids 357 to 386 (30 residues), 52.9 bits, see alignment (E = 6.8e-18) amino acids 407 to 436 (30 residues), 39.9 bits, see alignment (E = 8e-14) PF00595: PDZ" amino acids 491 to 556 (66 residues), 33.4 bits, see alignment E=1.5e-11 PF13180: PDZ_2" amino acids 496 to 566 (71 residues), 41.9 bits, see alignment E=3.1e-14 PF17820: PDZ_6" amino acids 505 to 558 (54 residues), 37.4 bits, see alignment 4.9e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1002)

Predicted SEED Role

"Serine protease precursor MucD/AlgY associated with sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8L9 at UniProt or InterPro

Protein Sequence (583 amino acids)

>AMB_RS05140 PDZ domain-containing protein (Magnetospirillum magneticum AMB-1)
MTMLDGDANTGGRPKAPRSKDLKRYLMLMGVVALIVLFGAFIFRQQAGGNRLGTLIRQLG
HGAVTAPVLPLPANALAGAPAATGVSALPPVMEAGAAQVGGGGGFSRVVSLLRHSVVSVT
ASSSGRAAAPKTLMPPGPYVLPRFANPTTTTVENIGTGVIVRDDGLIVTNFHVVRGANSV
LVSVSDNGGATRYSAEIVKMDEALDLALLKIAPRAPLTSAVLGDSSAVLVADEVIAIGTP
FGLDMSVSRGIISAKGKSMVIEGVTHSKLLQTDAAINQGNSGGPLVIADGTVIGINTAIY
TPSGAFAGIGFAVPSNQVRRFVEDEVNGLPAAAAAGPAMGAVAFRAPGSGGVGAAGPAIA
AGVPSPHTDGRQAMACDNCHQIIGAAAGPIAFAQPMMPVAAPPPAAPPIQANAANPHADN
RRNMNCAGCHQIIGAGAGPVAFAQPGAGGYQFAQPPGGLAVNVQGARGGIGSRMAGHSLH
GAALAPLSPQMSLQTGLPVGRGVLITGVSPNTAAANAGLRPGDVLLKIDGRPVALPHEAV
AIMGEMSVGGSVRLGVLRDGGVRNMTLIAGAAAGTPPPGNGPW