Protein Info for AMB_RS05010 in Magnetospirillum magneticum AMB-1

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 121 to 136 (16 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 17 to 294 (278 residues), 178.9 bits, see alignment E=6.7e-57 PF01545: Cation_efflux" amino acids 20 to 212 (193 residues), 155.6 bits, see alignment E=1.4e-49 PF16916: ZT_dimer" amino acids 218 to 290 (73 residues), 40.9 bits, see alignment E=1.9e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0978)

Predicted SEED Role

"Magnetosome protein MamV, Co/Zn/Cd cation transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8P3 at UniProt or InterPro

Protein Sequence (333 amino acids)

>AMB_RS05010 cation transporter (Magnetospirillum magneticum AMB-1)
MLGRPMKPSKCQECRDRAAWLDMFTALALAVFKTALGVLSGSMALQAHSLHSFGDFLTKG
INLASVKLSSRPANSAFPYGYGKVQFLSANFIGISLMAGAAAMLWYNVTHLGSGHVQVPE
VWAVFGALISAGTAELMHRYLRCVAEHTNSPAIMAAAADNRGDAYSSLAVLAGIVLSILG
WVAADHLAAILVSLLVLRIGAVIAWDSIHGLMDGSVPSHRIDGIRQLLAAHHPGVSVVDL
RGRRMGETWEVDLQLSISSQVTVEECHALTRELESRIAREEPHACHIRIRFIPQSGDATK
TAVIETAAAVDEFAYLVEASAALRPLGHSRNGG