Protein Info for AMB_RS04960 in Magnetospirillum magneticum AMB-1

Annotation: Na+/H+ antiporter NhaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 58 to 81 (24 residues), see Phobius details amino acids 95 to 125 (31 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 321 to 347 (27 residues), see Phobius details amino acids 358 to 383 (26 residues), see Phobius details amino acids 416 to 436 (21 residues), see Phobius details PF03600: CitMHS" amino acids 24 to 366 (343 residues), 160.5 bits, see alignment E=2.9e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0968)

Predicted SEED Role

"Magnetosome protein MamN, Na+/H+ antiporter NhaD related"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8Q3 at UniProt or InterPro

Protein Sequence (437 amino acids)

>AMB_RS04960 Na+/H+ antiporter NhaD (Magnetospirillum magneticum AMB-1)
MIGLLTLAVFVATFAVIYRWAEGSHLAVLAGAAALVVIGTISGSYTPVMALRSVYFETLA
LIFGMAAISALLARSGVYAYLAAGTAELSQGQGRWILVMMALVTYGISLASNSLVTVAVV
VPVTLTVCFRTGIDPVPVIIAEIIAANLGGASTMIGDFPNMILASAGKLHFNDFIAGMMP
VCLILLAVMLVFFERRLGDWKGSEIPVDPVWARGEALRHSAIDRRLLSYGLIIFGVTVAG
LILAGPLKVRPGWIAFVAGVTALGLGRFKDDEFFSACGGTDILFYGGLFVMVGALTSVGI
LDWAVNWLEGITAAHDRVRAILLMWMAAAVTIFVGGGTSAAVFAPVAATLRLDGDGQAAW
WALALGIMAGSVAALPGATAGSLAMTQYSGFVKRHPELASAAAAGLQFTHREYVRWGMPL
MGIFLVLGTVYIAVLVG