Protein Info for AMB_RS04955 in Magnetospirillum magneticum AMB-1

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 81 to 106 (26 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 185 to 201 (17 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 12 to 290 (279 residues), 177.2 bits, see alignment E=2.3e-56 PF01545: Cation_efflux" amino acids 15 to 209 (195 residues), 155 bits, see alignment E=2.2e-49 PF16916: ZT_dimer" amino acids 215 to 283 (69 residues), 54.4 bits, see alignment E=1.1e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0967)

Predicted SEED Role

"Magnetosome protein MamM, Co/Zn/Cd cation transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8Q4 at UniProt or InterPro

Protein Sequence (318 amino acids)

>AMB_RS04955 cation transporter (Magnetospirillum magneticum AMB-1)
MRKSGCTVCSRSIGWVGLAVNTVLMVMKAFVGLIGGSQAMLADAMYSLKDMLNALMVVIG
TTISSKPLDAEHPYGHGKVEFILSMVVSVVFIGLTGYLLVHAVQILLDESMHRTPHLIVL
WAALVSVGVNVAMYFYSRCVAIETNSPIIKTMAKHHHGDATASGAVALGIIGAHYLNMPW
IDPAVALWETIDLLLLGKVVFMDAYRGLMDHTAGEAVQNRIVDTAERVPGVRGVIHLRAR
YVGQDIWADMIIGVDPEHTVEQAHDICEAVQAAVCGKMRRIESLHVSAEAREAGDTSKPT
FSEEPLTYDEVMLSKVDN