Protein Info for AMB_RS04930 in Magnetospirillum magneticum AMB-1

Annotation: PDZ domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 728 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details PF00089: Trypsin" amino acids 169 to 336 (168 residues), 65.2 bits, see alignment E=2.3e-21 PF13365: Trypsin_2" amino acids 172 to 311 (140 residues), 104.2 bits, see alignment E=3.4e-33 PF18509: MCR" amino acids 373 to 402 (30 residues), 54.3 bits, see alignment (E = 2.5e-18) amino acids 419 to 448 (30 residues), 54.8 bits, see alignment (E = 1.7e-18) PF00595: PDZ" amino acids 503 to 569 (67 residues), 35.4 bits, see alignment E=3.3e-12 amino acids 660 to 717 (58 residues), 31.2 bits, see alignment 6.9e-11 PF13180: PDZ_2" amino acids 511 to 579 (69 residues), 47.4 bits, see alignment E=5.7e-16 PF17820: PDZ_6" amino acids 517 to 571 (55 residues), 44.2 bits, see alignment 3.8e-15 amino acids 665 to 719 (55 residues), 30.5 bits, see alignment 7.2e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0963)

Predicted SEED Role

"Magnetosome protein MamE, trypsin-like serine protease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8Q8 at UniProt or InterPro

Protein Sequence (728 amino acids)

>AMB_RS04930 PDZ domain-containing protein (Magnetospirillum magneticum AMB-1)
MAMFNGDVEDGGRGDASCGKDLKRYLMLMGVVALVVLFGAFIYRQSSGGLRLGAMLEQMG
RGTGPAVNVPVQQGGPSAAVNPAMSVPAGARVAPPSAAGAIATMPPMVDFGPAPIGAGGP
FSSVVTLLRNSVVAVTASSANGQAMPDPLGLANPDGLPHFANPATRSVENIGTGVIVRND
GFIVTNYHVVRGANSVFVTVQDDVGSTRYSAEIIKMDEALDLALLKVAPKTPLTAAVLGD
SDGVQVADEVIAIGTPFGLDMTVSRGIISAKRKSMVIEGVTHSNLLQTDAAINQGNSGGP
LVISNGTVVGINTAIYTPNGAFAGIGFAVPSNQARLFILDEVGWLPTSTAEGASMGLVAM
QRPMGGGVGAAGPAIFAGTRAPHTDGRQNMDCTTCHDLIPAGNGRPAPMMPIAAPIPPPP
IPMGAVSPHTDGRQNMNCANCHQMLGGAAPIAAPGLGGGAYRFAQPPGSLAINIQGPRGG
QSTAAGTGRVTLLGAALTPMSQRLGAQTGVPVGRGVFISGVTPNTPAATAGLRPGDVLLK
VDGRPVRLPEEVSAIMVEMHAGRSVRLGVLRDGDVRNMTLVAGPAGLAAAAVQAPAIADM
AQPPMGGMAPTAPGMVAVPGGPAVMPKPPTEFNWLGMEIETFQAPRPITGVPGAVPVPGA
KGAQVAEVLVGSRAAVAGLQANDLILEVNNRPVAGPARLDAAIKGATNAGQQILLKVNRN
GQEFWIVL