Protein Info for AMB_RS04815 in Magnetospirillum magneticum AMB-1

Annotation: iron permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 131 to 157 (27 residues), see Phobius details amino acids 169 to 193 (25 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 363 to 382 (20 residues), see Phobius details PF03239: FTR1" amino acids 60 to 248 (189 residues), 65.1 bits, see alignment E=3.5e-22 amino acids 234 to 338 (105 residues), 34.7 bits, see alignment E=6.4e-13

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 100% identity to mag:amb0937)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8T4 at UniProt or InterPro

Protein Sequence (391 amino acids)

>AMB_RS04815 iron permease (Magnetospirillum magneticum AMB-1)
MIRHIILAITMVVLAALPASAKTVDVPATISLILEGGDAAIAAYAPERKAATADAMSDLY
FDSFEASGLEGAIGMVDASWKIGLEGQFGQLIGKIRQGDSPEVVKAGWASLRANLAVVPS
RMAPKGGGFWSMFLQSFLILVREGFEAMLVITSLAAYLKRSAPEKVKVVYHGVGWAVIAS
LVTAWVVSALINVSGQGKELFEGCTMLLASVVLFYCSYWLFAKREAARWQSYVKEQISSA
LSGGRLFALGFAAFLAVYREGAETVLFYIALASGEPGQMTALLAGLGAACVALGALYVTM
NVMSIRLPLGVFFGVTAGLLYYLAVAFAGKGVVELQNAKVLPITPLEGWPSVDWLGLFPT
LEGATAQAILVVPLLVGILVLQFKKRAARAA