Protein Info for AMB_RS04725 in Magnetospirillum magneticum AMB-1

Annotation: transcriptional regulator NrdR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 TIGR00244: transcriptional regulator NrdR" amino acids 1 to 145 (145 residues), 170.9 bits, see alignment E=8.8e-55 PF03477: ATP-cone" amino acids 50 to 136 (87 residues), 79.2 bits, see alignment E=1.4e-26

Best Hits

Swiss-Prot: 100% identical to NRDR1_MAGSA: Transcriptional repressor NrdR 1 (nrdR1) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K07738, transcriptional repressor NrdR (inferred from 100% identity to mag:amb0919)

Predicted SEED Role

"Ribonucleotide reductase transcriptional regulator NrdR" in subsystem Ribonucleotide reduction

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8V2 at UniProt or InterPro

Protein Sequence (153 amino acids)

>AMB_RS04725 transcriptional regulator NrdR (Magnetospirillum magneticum AMB-1)
MRCPFCGHDDTQVKDSRPTDDNASIRRRRACPACASRFTTSERVQIRDLVVIKKDGSRST
FDRDKVVKSLQIALRKRPVDEEQIERIVNGIHRRLESLGENEVPSKLIGELVMDVLIGMD
QVAYLRYASVYRNFREAKDFGDFLGKMGRQGDD