Protein Info for AMB_RS04600 in Magnetospirillum magneticum AMB-1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 signal peptide" amino acids 12 to 12 (1 residues), see Phobius details transmembrane" amino acids 13 to 30 (18 residues), see Phobius details PF19425: Csd3_N2" amino acids 183 to 301 (119 residues), 28.9 bits, see alignment E=9.8e-11 PF01551: Peptidase_M23" amino acids 313 to 410 (98 residues), 115.8 bits, see alignment E=8.4e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0902)

Predicted SEED Role

"Peptidase, M23/M37 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8W9 at UniProt or InterPro

Protein Sequence (462 amino acids)

>AMB_RS04600 membrane protein (Magnetospirillum magneticum AMB-1)
MAALVTAKLLRSLKALAIALVVAGVAVMVSRPYVSFSPFGEEGGTLDSAPPSYVDMESEG
SAQPSPELSDGELEDRSGRPVDHVLQVGSGETLASLLGRAGIPSADTSQVIEALVKVFDP
RDLKAGQKVTVTFDPSPWGFGQGPFSQVGLAADPIREIQVRRNPKGGFIGREERRQVTRQ
VAHFSGKIKSSLFESATAAGIPAQAIINMIRVLSYDVDFQRDIQAGDSFEVLFDGWYDTK
GKLVKSGDILYAGLDLSGAEVTLYRFEDGSGASDFFNGKGESAKKALLKTPVDGAKITSG
FGLRHHPILGFSKMHKGVDFGVPPGTPIMAAGDGSVDMAGPNGAYGNYVRIRHGNGFSTA
YAHMQRIAQGVHTGRRIMQGQIIGFVGSTGRSTGPHLHYEVLQGNNQVNPLSIKVPTGIK
LAGRDMDRYQAHKRATDLLMAQIPSGAHVASNPGKPVQAKAN