Protein Info for AMB_RS04520 in Magnetospirillum magneticum AMB-1

Annotation: glycine zipper 2TM domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 48 to 66 (19 residues), see Phobius details PF16998: 17kDa_Anti_2" amino acids 96 to 155 (60 residues), 43.3 bits, see alignment E=1.4e-15

Best Hits

Swiss-Prot: 43% identical to 17KD_RICBE: 17 kDa surface antigen (omp) from Rickettsia bellii

KEGG orthology group: None (inferred from 100% identity to mag:amb0887)

Predicted SEED Role

"17 kDa antigen"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8Y4 at UniProt or InterPro

Protein Sequence (157 amino acids)

>AMB_RS04520 glycine zipper 2TM domain-containing protein (Magnetospirillum magneticum AMB-1)
MRPQAPKFVSALLALSLLGGCADAKLGQTGGAILGGIGGGLLGSQFGGGIGRVLMTSLGA
ALGAYAGSELGKKLDKADKEEVLKAEEKAQDGPVGETIAWSNPQSGNSGTVTPVSENTDA
QGRTCRDYQSTITVDGKDETVTGTACKQADGSWSAVN