Protein Info for AMB_RS04505 in Magnetospirillum magneticum AMB-1

Annotation: YqgE/AlgH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 PF02622: DUF179" amino acids 19 to 177 (159 residues), 167.3 bits, see alignment E=1.3e-53

Best Hits

Swiss-Prot: 59% identical to Y3059_RHORT: UPF0301 protein Rru_A3059 (Rru_A3059) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K07735, putative transcriptional regulator (inferred from 65% identity to rce:RC1_3645)

Predicted SEED Role

"UPF0301 protein YqgE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>AMB_RS04505 YqgE/AlgH family protein (Magnetospirillum magneticum AMB-1)
MPTQKTTGYLAGQILIAMPQMEDPRFARAIVYLCAHTADGAMGIVVNKLFGGLTFPELLE
QLEIPATPACDEIRVHFGGPVESGRGFVLHSADYQHENTMLVEGDVALTATVDVLRAMAD
GTGPRESLLALGYAGWGSGQLDMEIRENSWLTVPADPALLFSRDLEHKYERAIHKLGIDV
GLLSASAGHA