Protein Info for AMB_RS04505 in Magnetospirillum magneticum AMB-1
Annotation: YqgE/AlgH family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to Y3059_RHORT: UPF0301 protein Rru_A3059 (Rru_A3059) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
KEGG orthology group: K07735, putative transcriptional regulator (inferred from 65% identity to rce:RC1_3645)Predicted SEED Role
"UPF0301 protein YqgE"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (190 amino acids)
>AMB_RS04505 YqgE/AlgH family protein (Magnetospirillum magneticum AMB-1) MPTQKTTGYLAGQILIAMPQMEDPRFARAIVYLCAHTADGAMGIVVNKLFGGLTFPELLE QLEIPATPACDEIRVHFGGPVESGRGFVLHSADYQHENTMLVEGDVALTATVDVLRAMAD GTGPRESLLALGYAGWGSGQLDMEIRENSWLTVPADPALLFSRDLEHKYERAIHKLGIDV GLLSASAGHA