Protein Info for AMB_RS04475 in Magnetospirillum magneticum AMB-1

Annotation: S41 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 116 to 417 (302 residues), 227.7 bits, see alignment E=1e-71 PF13180: PDZ_2" amino acids 157 to 235 (79 residues), 45.1 bits, see alignment E=2e-15 PF00595: PDZ" amino acids 157 to 217 (61 residues), 31.7 bits, see alignment E=3.3e-11 PF17820: PDZ_6" amino acids 172 to 226 (55 residues), 45.4 bits, see alignment 1.1e-15 PF03572: Peptidase_S41" amino acids 253 to 414 (162 residues), 146.6 bits, see alignment E=1.1e-46

Best Hits

Predicted SEED Role

"carboxyl-terminal protease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>AMB_RS04475 S41 family peptidase (Magnetospirillum magneticum AMB-1)
MGAGFALAVSLLSPPAAAGWVAGEAERTIAFGFDAIVERHLQPVTAQTIALDGLRGLAEI
DPQLAVTLDQGRLRLSTTEKVVVDFPAASPDDTVGWARITVNAALEASQMSERLRDADAE
RLYQAVFEGALGKADLFSRYAGAREAREHRSNRSGFGGIGIKFDLIDSEVRIVEVVDDGP
AAKLGLRAGDIITAIDGDPVRGLDRADISNKLRGAVATELVLALRRGSQMLQFTLRRSLI
VPQTVSSSVAGGIAHFKITSFNQRTAYSLENQLKDIRDRLGGGLQGVVLDLRGNPGGLLD
KAVAVVDLFVAEGTIISTRGRHPASANSFEAKPGDIGEDLPLAVLVDGRSASAAEIVASA
LQDAGRAVVIGTNSYGKGTVQTVVRLPNDGEITLTWSRFHAPSGYALHGLGVLPVLCTGA
ATQTAAQMVEAIGRGTLPGKPAETLAVWRGTGIDDTELRHRLRDTCPPARLGDNRLEMDL
ADRLLSNRAAYARALAASAPTRGLEALQTRPSPETGSH