Protein Info for AMB_RS04380 in Magnetospirillum magneticum AMB-1

Annotation: EamA/RhaT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 214 to 231 (18 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details PF00892: EamA" amino acids 17 to 137 (121 residues), 54.4 bits, see alignment E=7.8e-19 amino acids 150 to 283 (134 residues), 67 bits, see alignment E=9.7e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0860)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W911 at UniProt or InterPro

Protein Sequence (301 amino acids)

>AMB_RS04380 EamA/RhaT family transporter (Magnetospirillum magneticum AMB-1)
MAMTAPSRLTPLEWASATLVVTLWGLNFVAVKTALGTLPPFLLTALRFACTALILAPFFR
PSRAQLPGILLLALLLGVGHFGLMFFGVAGMDAATAAIVIELSIPFSAILAWAFFGEVLG
VWRSLGLAVSFIGVALLAGEPHLPRLTPFIAVVASGFAWALANVVIKRLGAINPLALNGW
MAMLASPLLLGLSLATESGQMEALAATGIKGWSGVAYTIVGSTLIAYTLWYRLIARHPMN
RVVPFTLLGPVVGLAGGVLLLGEPLTWHKLVGGALTVLGVAVVELLPGRAIHRAEEPEPG
T