Protein Info for AMB_RS04300 in Magnetospirillum magneticum AMB-1

Annotation: beta-ketoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01829: acetoacetyl-CoA reductase
  • amino acids 3 to 239 (237 residues), 344 bits, E=2.5e-107
• PF00106: adh_short
  • amino acids 4 to 188 (185 residues), 189.7 bits, E=1e-59
• PF08659: KR
  • amino acids 6 to 167 (162 residues), 64.5 bits, E=3.1e-21
• PF13561: adh_short_C2
  • amino acids 12 to 238 (227 residues), 196.9 bits, E=1e-61
• PF23441: SDR
  • amino acids 147 to 237 (91 residues), 32 bits, E=2.1e-11

Best Hits

Swiss-Prot: 66% identical to PHAB_RHIME: Acetoacetyl-CoA reductase (phaB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00023, acetoacetyl-CoA reductase [EC: 1.1.1.36] (inferred from 100% identity to mag:amb0843)

MetaCyc: 64% identical to acetoacetyl-CoA reductase subunit (Zoogloea ramigera)
Acetoacetyl-CoA reductase. [EC: 1.1.1.36]; 1.1.1.36 [EC: 1.1.1.36]

Predicted SEED Role

"Acetoacetyl-CoA reductase (EC 1.1.1.36)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle (EC 1.1.1.36)

MetaCyc Pathways

• polyhydroxybutanoate biosynthesis (3/3 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (3/4 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• ethylmalonyl-CoA pathway (7/11 steps found)
• acetyl-CoA fermentation to butanoate (4/7 steps found)
• 4-oxopentanoate degradation (4/9 steps found)

KEGG Metabolic Maps

• Butanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.36

Sequence Analysis Tools

See Q2W928 at UniProt or InterPro

Protein Sequence (240 amino acids)

>AMB_RS04300 beta-ketoacyl-ACP reductase (Magnetospirillum magneticum AMB-1)
MGRLAIVTGGTRGIGREISVTLKKAGYKVVANYGGNDEAAAKFTAETGIPSMKWDVGSYP
ACEAAIAKIVAEHGPVEIIVNNAGITRDATLHRMSYQMWEEVIHTNLTSCFNMARLAIDS
MRERGFGRIVNIGSINGQAGQYGQVNYAAAKSGIHGFTKALAQEGAAKNITVNAIAPGYV
DTDMVRAVPPAVLEKIIAKIPVGRLGRAEDIARCVMFLIADEADFITGSTLSVNGGQHMY