Protein Info for AMB_RS04290 in Magnetospirillum magneticum AMB-1

Annotation: poly-beta-hydroxybutyrate polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF07167: PhaC_N" amino acids 75 to 107 (33 residues), 27.4 bits, see alignment 6.3e-10 PF00561: Abhydrolase_1" amino acids 81 to 348 (268 residues), 67.2 bits, see alignment E=4.7e-22 PF12697: Abhydrolase_6" amino acids 104 to 291 (188 residues), 32.5 bits, see alignment E=3.7e-11 PF01738: DLH" amino acids 133 to 180 (48 residues), 21.8 bits, see alignment 3.1e-08

Best Hits

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 100% identity to mag:amb0841)

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W930 at UniProt or InterPro

Protein Sequence (368 amino acids)

>AMB_RS04290 poly-beta-hydroxybutyrate polymerase (Magnetospirillum magneticum AMB-1)
MAEAGRTLAQSLDAAGPDAWTRLDEAIAAEAVRRHDAFLDGIEAYRHHPYRRDLPPAPEA
WRQGTTSLRDYRQPESDDARPVLVIPSLINRAYILDLSEKRSLMRYLAAKGLAPFLVDWD
APGEAEKSFTLTDYIAGRLEAALDEVVRLTGHRPAVVGYCMGGLLALALAQRRPDAVSAL
VLLATPYDFVTGREANAVLMKALAQPMGGLIDGVGEVPVDMLQAMFAGLDPGLAARKFMA
FARLKRRSARARDFVALEDWANDGVPLAGPVARECLFGWYGENDPVEGRWCIEGRPVNPG
EVTVPTLVMIPQRDRIVPPVSALPLWERIPSAKLMRLSGGHVGMLTGPRAKTEVYGPLMR
WLHRRAGT