Protein Info for AMB_RS04245 in Magnetospirillum magneticum AMB-1

Annotation: (R)-hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF13452: MaoC_dehydrat_N" amino acids 22 to 133 (112 residues), 30.9 bits, see alignment E=2.7e-11 PF01575: MaoC_dehydratas" amino acids 23 to 117 (95 residues), 93.7 bits, see alignment E=6.6e-31

Best Hits

Swiss-Prot: 66% identical to PHAJ_RHORT: (R)-specific enoyl-CoA hydratase (phaJ) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: None (inferred from 100% identity to mag:amb0831)

Predicted SEED Role

"MaoC family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W940 at UniProt or InterPro

Protein Sequence (144 amino acids)

>AMB_RS04245 (R)-hydratase (Magnetospirillum magneticum AMB-1)
MSGESLNGMYFEELSVGQSAIFAKTVTEADIVAFAGVSGDFNPVHINEEFASQTMFKGRI
AHGMLSAAFVSTVFGTKLPGPGCIYVSQLLKFKAPVRIGDTVTARVEVTALTPEKKFATF
KTTCSVAGKIVMDGEATLMVPSKG